missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Staufen Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38615-25ul
This item is not returnable.
View return policy
Description
Staufen Polyclonal specifically detects Staufen in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Staufen | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| O95793 | |
| STAU1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| double-stranded RNA-binding protein Staufen homolog 1, FLJ25010, RNA binding protein (Drosophila), RNA-binding protein), staufen, RNA binding protein, homolog 1 (Drosophila) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 6780 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction