missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STT3B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | STT3B |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18674401
|
Novus Biologicals
NBP2-93315-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661401
|
Novus Biologicals
NBP2-93315-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STT3B Polyclonal antibody specifically detects STT3B in Human, Mouse samples. It is validated for Western BlotSpecifications
| STT3B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| FLJ90106, homolog of yeast STT3, Oligosaccharyl transferase subunit STT3B, SIMPEC 2.4.1.119, source of immunodominant MHC associated peptides, Source of immunodominant MHC-associated peptides homolog, STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae), STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STT3B (NP_849193.1). MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 201595 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title