missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAS2R39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00 € - 515.00 €
Specifications
| Antigen | TAS2R39 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TAS2R39 Polyclonal specifically detects TAS2R39 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TAS2R39 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 259285 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| T2R39, T2R57, taste receptor type 2 member 39, Taste receptor type 2 member 57, taste receptor, type 2, member 39 | |
| TAS2R39 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title