missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBC1D22B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 572.00 €
Specifications
| Antigen | TBC1D22B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18405051
|
Novus Biologicals
NBP1-86751-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18230167
|
Novus Biologicals
NBP1-86751 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TBC1D22B Polyclonal specifically detects TBC1D22B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TBC1D22B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55633 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QHPPLDPRLTKNFIKERSKVNTVPLKNKKASSFHEFARNTSDAWDIGDDEEEDFSSPSFQTLNSK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| Human | |
| C6orf197, chromosome 6 open reading frame 197, dJ744I24.2, DKFZp762J0110, FLJ20337, MGC125626, MGC125627, RP4-744I24.2, TBC1 domain family member 22B, TBC1 domain family, member 22B | |
| TBC1D22B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title