missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCEAL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | TCEAL5 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18234975
|
Novus Biologicals
NBP2-54723 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692758
|
Novus Biologicals
NBP2-54723-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCEAL5 Polyclonal specifically detects TCEAL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TCEAL5 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 340543 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| TCEA-like protein 5, transcription elongation factor A (SII)-like 5, transcription elongation factor A protein-like 5, Transcription elongation factor S-II protein-like 5 | |
| TCEAL5 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title