missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEPAI Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93857-0.02ml
This item is not returnable.
View return policy
Description
TMEPAI Polyclonal antibody specifically detects TMEPAI in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| TMEPAI | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1). PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL | |
| 0.02 mL | |
| Signal Transduction | |
| 56937 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction