missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEPAI Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | TMEPAI |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637241
|
Novus Biologicals
NBP2-93857-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667150
|
Novus Biologicals
NBP2-93857-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEPAI Polyclonal antibody specifically detects TMEPAI in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| TMEPAI | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 56937 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1). PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title