missing translation for 'onlineSavingsMsg'
Learn More

TRPC1 Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30487273 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30487273 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30487273 Supplier Novus Biologicals Supplier No. NBP335247FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TRPC1 Polyclonal antibody specifically detects TRPC1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRPC1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias HTRP-1, MGC133334, MGC133335, transient receptor potential canonical 1, transient receptor potential cation channel, subfamily C, member 1, transient receptor potential channel 1, Transient receptor protein 1, TRP-1, TRP1short transient receptor potential channel 1, TrpC1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).,, Sequence:, LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7220
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.