missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tryptophan hydroxylase 2 Antibody (CL2990), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-46646
This item is not returnable.
View return policy
Description
Tryptophan hydroxylase 2 Monoclonal antibody specifically detects Tryptophan hydroxylase 2 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Tryptophan hydroxylase 2 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| ADHD7, EC 1.14.16, EC 1.14.16.4, FLJ37295, MGC138872, Neuronal tryptophan hydroxylase, NTPHMGC138871, tryptophan 5-hydroxylase 2, Tryptophan 5-monooxygenase 2, tryptophan hydroxylase 2 | |
| Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 121278 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL2990 | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q8IWU9 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction