missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tryptophan hydroxylase 2 Antibody (CL2990), Novus Biologicals™
Mouse Monoclonal Antibody
369.00 € - 564.00 €
Specifications
| Antigen | Tryptophan hydroxylase 2 |
|---|---|
| Clone | CL2990 |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18664645
|
Novus Biologicals
NBP2-46646-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686665
|
Novus Biologicals
NBP2-46646 |
0.1 mL |
564.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tryptophan hydroxylase 2 Monoclonal antibody specifically detects Tryptophan hydroxylase 2 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Tryptophan hydroxylase 2 | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Q8IWU9 | |
| 121278 | |
| IgG1 | |
| Protein A purified |
| CL2990 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Lipid and Metabolism | |
| PBS (pH 7.2), 40% Glycerol | |
| ADHD7, EC 1.14.16, EC 1.14.16.4, FLJ37295, MGC138872, Neuronal tryptophan hydroxylase, NTPHMGC138871, tryptophan 5-hydroxylase 2, Tryptophan 5-monooxygenase 2, tryptophan hydroxylase 2 | |
| Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title