missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TULA/STS-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48637
This item is not returnable.
View return policy
Description
TULA/STS-2 Polyclonal antibody specifically detects TULA/STS-2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| TULA/STS-2 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Cbl-interacting protein 4, gene similar to UBA containing SH3 domain10CLIP4STS-2T-cell ubiquitin ligand protein, STS2, Suppressor of T-cell receptor signaling 2, T-cell ubiquitin ligand, TULAubiquitin-associated and SH3 domain-containing protein A, ubiquitin associated and SH3 domain containing A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 53347 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction