missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TULA/STS-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | TULA/STS-2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18682258
|
Novus Biologicals
NBP2-48637-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604357
|
Novus Biologicals
NBP2-48637 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TULA/STS-2 Polyclonal antibody specifically detects TULA/STS-2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| TULA/STS-2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Cbl-interacting protein 4, gene similar to UBA containing SH3 domain10CLIP4STS-2T-cell ubiquitin ligand protein, STS2, Suppressor of T-cell receptor signaling 2, T-cell ubiquitin ligand, TULAubiquitin-associated and SH3 domain-containing protein A, ubiquitin associated and SH3 domain containing A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 53347 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title