missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TZFP Polyclonal antibody specifically detects TZFP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TZFP |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | Fanconi anemia zinc finger protein, FAXF, FAZFFANCC-interacting protein, ROG, Testis zinc finger protein, TZFPZinc finger protein 538, zinc finger and BTB domain containing 32, zinc finger and BTB domain-containing protein 32, ZNF538FAXFrepressor of GATA |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?