missing translation for 'onlineSavingsMsg'
Learn More
Learn More
u-Plasminogen Activator/Urokinase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
329.00 € - 564.00 €
Specifications
| Antigen | u-Plasminogen Activator/Urokinase |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18691935
|
Novus Biologicals
NBP3-21338-100ul |
100 μg |
564.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626384
|
Novus Biologicals
NBP3-21338-25ul |
25 μg |
329.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
u-Plasminogen Activator/Urokinase Polyclonal antibody specifically detects u-Plasminogen Activator/Urokinase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| u-Plasminogen Activator/Urokinase | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, 40% glycerol | |
| 5328 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATF, EC 3.4.21, EC 3.4.21.73, plasminogen activator, urokinase, uPA, u-PA, U-plasminogen activator, urinary, urokinase-type plasminogen activator | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title