missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UACA Polyclonal antibody specifically detects UACA in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | UACA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 750 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | FLJ10128, KIAA1561MGC141969, MGC141967, nuclear membrane binding protein, NUCLING, uveal autoantigen with coiled coil domains and ankyrin repeats, uveal autoantigen with coiled-coil domains and ankyrin repeats |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human UACA (NP_060473.2).,, Sequence:, MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?