missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBAC2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94480-0.02ml
This item is not returnable.
View return policy
Description
UBAC2 Polyclonal antibody specifically detects UBAC2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| UBAC2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| FLJ26351, FLJ30001, FLJ42413, MGC90487, PHGDHL1, phosphoglycerate dehydrogenase-like protein 1, RP11-178C10.1, UBA domain containing 2, ubiquitin-associated domain-containing protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1). PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV | |
| 0.02 mL | |
| Cell Biology | |
| 337867 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction