missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBAC2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | UBAC2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18638140
|
Novus Biologicals
NBP2-94480-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18644311
|
Novus Biologicals
NBP2-94480-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBAC2 Polyclonal antibody specifically detects UBAC2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| UBAC2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 337867 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ26351, FLJ30001, FLJ42413, MGC90487, PHGDHL1, phosphoglycerate dehydrogenase-like protein 1, RP11-178C10.1, UBA domain containing 2, ubiquitin-associated domain-containing protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1). PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title