missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UbcH8/Ube2L6 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
UbcH8/Ube2L6 Polyclonal antibody specifically detects UbcH8/Ube2L6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | UbcH8/Ube2L6 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 532 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-153 of human UbcH8/Ube2L6 (NP_004214.1).,, Sequence:, AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?