missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2W Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94761-0.1ml
This item is not returnable.
View return policy
Description
UBE2W Polyclonal antibody specifically detects UBE2W in Human, Mouse samples. It is validated for Western Blot
Specifications
| UBE2W | |
| Polyclonal | |
| Western Blot 1:500-1:1000 | |
| EC 6.3.2.19, FLJ11011, hUBC-16, probable ubiquitin-conjugating enzyme E2 W, Ubiquitin carrier protein W, ubiquitin-conjugating enzyme 16, ubiquitin-conjugating enzyme E2W (putative), Ubiquitin-protein ligase W | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 40-110 of human UBE2W (NP_001001481.2). VEVWFPKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ | |
| 0.1 mL | |
| Cell Biology | |
| 55284 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction