missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2W Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
221.00 € - 470.00 €
Specifications
| Antigen | UBE2W |
|---|---|
| Dilution | Western Blot 1:500-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18608741
|
Novus Biologicals
NBP2-94761-0.02ml |
0.02 mL |
221.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648652
|
Novus Biologicals
NBP2-94761-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBE2W Polyclonal antibody specifically detects UBE2W in Human, Mouse samples. It is validated for Western BlotSpecifications
| UBE2W | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 55284 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 6.3.2.19, FLJ11011, hUBC-16, probable ubiquitin-conjugating enzyme E2 W, Ubiquitin carrier protein W, ubiquitin-conjugating enzyme 16, ubiquitin-conjugating enzyme E2W (putative), Ubiquitin-protein ligase W | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 40-110 of human UBE2W (NP_001001481.2). VEVWFPKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title