missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBIAD1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | UBIAD1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18676292
|
Novus Biologicals
NBP2-94124-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694342
|
Novus Biologicals
NBP2-94124-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBIAD1 Polyclonal antibody specifically detects UBIAD1 in Human, Mouse samples. It is validated for Western BlotSpecifications
| UBIAD1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.3), 50% glycerol | |
| 29914 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-338 of human UBIAD1 (NP_037451.1). ILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title