missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UFD1L Polyclonal antibody specifically detects UFD1L in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | UFD1L |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ATP1C, ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide, FXYD domain containing ion transport regulator 2, FXYD domain-containing ion transport regulator 2, HOMG2, hypomagnesemia 2, renal, MGC12372, Na(+)/K(+) ATPase subunit gamma, Sodium pump gamma chain, sodium/potassium-transporting ATPase subunit gamma, Sodium-potassium-ATPase, gamma polypeptide |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?