missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UPP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80647
This item is not returnable.
View return policy
Description
UPP2 Polyclonal antibody specifically detects UPP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| UPP2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| EC 2.4.2.3, liver-specific uridine phosphorylase, UDRPASE2, UP2, UPase 2, UPASE2, UrdPase 2, uridine phosphorylase 2, uridine phosphorylase-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCT | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 151531 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction