missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UPP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 725.00 €
Specifications
| Antigen | UPP2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18470731
|
Novus Biologicals
NBP1-80647-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18459490
|
Novus Biologicals
NBP1-80647 |
0.1 mL |
725.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UPP2 Polyclonal antibody specifically detects UPP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| UPP2 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 151531 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.4.2.3, liver-specific uridine phosphorylase, UDRPASE2, UP2, UPase 2, UPASE2, UrdPase 2, uridine phosphorylase 2, uridine phosphorylase-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title