missing translation for 'onlineSavingsMsg'
Learn More

USP13 Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30489073 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30489073 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30489073 Supplier Novus Biologicals Supplier No. NBP335117FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

USP13 Polyclonal antibody specifically detects USP13 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen USP13
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias Deubiquitinating enzyme 13, EC 3.1.2.15, EC 3.4.19.12, Isopeptidase T-3, ISOT-3, ISOT3IsoT-3, ubiquitin carboxyl-terminal hydrolase 13, ubiquitin specific peptidase 13 (isopeptidase T-3), ubiquitin specific protease 13 (isopeptidase T-3), ubiquitin thioesterase 13, Ubiquitin thiolesterase 13, Ubiquitin-specific-processing protease 13
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).,, Sequence:, MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8975
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.