missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP13 Polyclonal antibody specifically detects USP13 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | USP13 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Deubiquitinating enzyme 13, EC 3.1.2.15, EC 3.4.19.12, Isopeptidase T-3, ISOT-3, ISOT3IsoT-3, ubiquitin carboxyl-terminal hydrolase 13, ubiquitin specific peptidase 13 (isopeptidase T-3), ubiquitin specific protease 13 (isopeptidase T-3), ubiquitin thioesterase 13, Ubiquitin thiolesterase 13, Ubiquitin-specific-processing protease 13 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).,, Sequence:, MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?