missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP22 Polyclonal antibody specifically detects USP22 in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | USP22 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | Deubiquitinating enzyme 22, EC 3.1.2.15, EC 3.4.19.12, KIAA1063ubiquitin carboxyl-terminal hydrolase 22, KIAA1064, ubiquitin specific peptidase 22, ubiquitin specific peptidase 3-like, ubiquitin specific protease 22, ubiquitin thioesterase 22, Ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22, Ubiquitin-specific-processing protease 22, USP3L |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human USP22 (NP_056091.1). TAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?