missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. USP33 Antibody, Novus Biologicals™

USP33 Antibody, Novus Biologicals™

Product Code. p-200103929 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30230223 100 μL 100µL
30228595 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30230223 Supplier Novus Biologicals Supplier No. NBP335652100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

USP33 Polyclonal antibody specifically detects USP33 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen USP33
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Deubiquitinating enzyme 33, EC 3.1.2.15, EC 3.4.19.12, hVDU1, KIAA1097MGC16868, pVHL-interacting deubiquitinating enzyme 1, ubiquitin carboxyl-terminal hydrolase 33, ubiquitin specific peptidase 33, ubiquitin thioesterase 33, Ubiquitin thiolesterase 33, Ubiquitin-specific-processing protease 33, VDU1ubiquitin specific protease 33, VHL-interacting deubiquitinating enzyme 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).,, Sequence:, QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Turnover, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 23032
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.