missing translation for 'onlineSavingsMsg'
Learn More

USP46 Antibody, Novus Biologicals™

Product Code. p-200045429 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18431331 25 μL 25µL
18228265 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18431331 Supplier Novus Biologicals Supplier No. NBP18229325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 1 publication

USP46 Polyclonal specifically detects USP46 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen USP46
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), ChIP Assay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200 - 1:500, Chromatin Immunoprecipitation (ChIP)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P62068
Gene Alias Deubiquitinating enzyme 46, EC 3.1.2.15, EC 3.4.19.12, FLJ11850, FLJ12552, FLJ14283, FLJ39393, ubiquitin carboxyl-terminal hydrolase 46, ubiquitin specific peptidase 46, ubiquitin specific protease 46, ubiquitin thioesterase 46, Ubiquitin thiolesterase 46, Ubiquitin-specific-processing protease 46
Gene Symbols USP46
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
Molecular Weight of Antigen 42 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 64854
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.