missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VSIG10 Antibody, R&D Systems™

VSIG10 Antibody, R&D Systems™

Product Code. 18606277 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18606277 100 μg 100µL
18650369 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18606277 Supplier Novus Biologicals Supplier No. NBP268783
  • ONLINE EXCLUSIVE PRICE
    628.19 €
    590.10 € / 100µL
    Save 38.09 €
    6% Off
 Restricted Item
Estimated Shipment: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

VSIG10 Polyclonal antibody specifically detects VSIG10 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen VSIG10
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias FLJ20674, V-set and immunoglobulin domain containing 10, V-set and immunoglobulin domain-containing protein 10
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
Purification Method Protein A purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54621
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.