missing translation for 'onlineSavingsMsg'
Learn More

WDR77 Antibody [FITC], Novus Biologicals Biologicals™

Product Code. 30511610 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30511610 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30511610 Supplier Novus Biologicals Supplier No. NBP338391F

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

WDR77 Polyclonal antibody specifically detects WDR77 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen WDR77
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate FITC
Formulation PBS
Gene Alias Androgen receptor cofactor p44, MEP-50, MEP50Nbla10071, methylosome protein 50, MGC2722, p44, p44/Mep50, RP11-552M11.3, WD repeat domain 77, WD repeat-containing protein 77
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1).,, Sequence:, DLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 79084
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.