missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Xanthine Oxidase Polyclonal antibody specifically detects Xanthine Oxidase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Xanthine Oxidase |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Biotin |
| Formulation | PBS |
| Gene Alias | EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 985-1084 of human Xanthine Oxidase (XDH) (NP_000370.2).,, Sequence:, CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?