missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XKR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | XKR6 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18608416
|
Novus Biologicals
NBP2-68822-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651627
|
Novus Biologicals
NBP2-68822 |
100 μg |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
XKR6 Polyclonal antibody specifically detects XKR6 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| XKR6 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C8orf5, C8orf7, FLJ31557, Transmembrane protein C8orf5, X Kell blood group precursor-related family, member 6, XK, Kell blood group complex subunit-related family, member 6, XK-related protein 6, XRG6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 286046 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title