missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
XPF Polyclonal antibody specifically detects XPF in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Specifications
Specifications
| Antigen | XPF |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DNA excision repair protein ERCC-4, DNA repair protein complementing XP-F cells, EC 3.1, ERCC11, excision repair cross-complementing rodent repair deficiency, complementationgroup 4, xeroderma pigmentosum, complementation group F, XPFcomplementing defective, in Chinese hamster |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 513-782 of human XPF (NP_005227.1).,, Sequence:, GKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?