missing translation for 'onlineSavingsMsg'
Learn More

XPF Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™

Product Code. 30515038 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30515038 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30515038 Supplier Novus Biologicals Supplier No. NBP338510JF669

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

XPF Polyclonal antibody specifically detects XPF in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen XPF
Applications ELISA, Immunoprecipitation, Western Blot
Classification Polyclonal
Conjugate Janelia Fluor 669
Formulation 50mM Sodium Borate
Gene Alias DNA excision repair protein ERCC-4, DNA repair protein complementing XP-F cells, EC 3.1, ERCC11, excision repair cross-complementing rodent repair deficiency, complementationgroup 4, xeroderma pigmentosum, complementation group F, XPFcomplementing defective, in Chinese hamster
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 513-782 of human XPF (NP_005227.1).,, Sequence:, GKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, DNA Repair, Nucleotide Excision Repair
Primary or Secondary Primary
Gene ID (Entrez) 2072
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.