missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 539.00 €
Specifications
| Antigen | ZDHHC2 |
|---|---|
| Dilution | Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18449501
|
Novus Biologicals
NBP2-13541-25ul |
25 ul |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18089318
|
Novus Biologicals
NBP2-13541 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZDHHC2 Polyclonal specifically detects ZDHHC2 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZDHHC2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51201 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| DHHC2, DHHC-2, EC 2.3.1, EC 2.3.1.-, palmitoyltransferase ZDHHC2, Ream, REC, Reduced expression associated with metastasis protein, Reduced expression in cancer protein, Zinc finger DHHC domain-containing protein 2, Zinc finger protein 372, zinc finger, DHHC domain containing 2, zinc finger, DHHC-type containing 2, ZNF372rec | |
| ZDHHC2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title