missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF286B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38115
This item is not returnable.
View return policy
Description
ZNF286B Polyclonal specifically detects ZNF286B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ZNF286B | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P0CG31 | |
| ZNF286B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Putative Zinc Finger Protein 286B, Zinc Finger 286C Pseudogene, Zinc Finger Protein 286B, Zinc Finger Protein 286-Like, Zinc Finger Protein 590, ZNF286C, ZNF286L, ZNF590 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 729288 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur